Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFL2 Rabbit Polyclonal Antibody (HRP)

IGFL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UNQ645, VPRI645

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IGFL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCES

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001002915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEPCE Rabbit pAb (APR27128N)
APR27128N-01 50 µL

MEPCE Rabbit pAb (APR27128N)

Sign In for Pricing
View Details
MEPCE Rabbit pAb (APR27128N)
APR27128N-02 100 µL

MEPCE Rabbit pAb (APR27128N)

Sign In for Pricing
View Details
MEPCE Rabbit pAb (APR27128N)
APR27128N-03 200 µL

MEPCE Rabbit pAb (APR27128N)

Sign In for Pricing
View Details
IMMT Antibody - middle region
MBS3224069-01 0.1 mL

IMMT Antibody - middle region

Sign In for Pricing
View Details
IMMT Antibody - middle region
MBS3224069-02 5x 0.1 mL

IMMT Antibody - middle region

Sign In for Pricing
View Details
Lyzl1 Mouse shRNA Plasmid (Locus ID 67328)
TL514295 1 Kit

Lyzl1 Mouse shRNA Plasmid (Locus ID 67328)

Sign In for Pricing
View Details