Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM172A Rabbit Polyclonal Antibody (FITC)

FAM172A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Toupee, C5orf21

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FAM172A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001156889

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF574 Human Gene Knockout Kit (CRISPR)
KN400837 1 Kit

ZNF574 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Ficolin-2, C-His Tag
HA211174-01 20 µg

Human Ficolin-2, C-His Tag

Sign In for Pricing
View Details
Human Ficolin-2, C-His Tag
HA211174-02 50 µg

Human Ficolin-2, C-His Tag

Sign In for Pricing
View Details
Human Ficolin-2, C-His Tag
HA211174-03 100 µg

Human Ficolin-2, C-His Tag

Sign In for Pricing
View Details
Prrg2 (NM_022999) Mouse Tagged ORF Clone
MG201969 10 µg

Prrg2 (NM_022999) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GNA14 (N-term) Rabbit Polyclonal Antibody
AP51871PU-N 400 µL

GNA14 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details