Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTKD3 Rabbit Polyclonal Antibody (HRP)

FASTKD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ23274, MGC142123, MGC5297

UniProt

Q14CZ7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FASTKD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HPLGGPVFSQVSDCDRLEQNVKNEESQMFYRRLSNLTSSEEVLSFISTME

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_076996

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mean grain size 500 nm, concentration 50 mg/mL, binding capacity 10.5 μg/mg
NAEB181818A 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Mean grain size 500 nm, concentration 50 mg/mL, binding capacity 10.5 μg/mg

Sign In for Pricing
View Details
FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (FITC)
246155-FITC 100 µL

FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (FITC)

Sign In for Pricing
View Details
Bovine Keratin 15 (KRT15) ELISA Kit
OM624623 96 Strip Well

Bovine Keratin 15 (KRT15) ELISA Kit

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to Cystatin 4 (CST4)
MBS2110688-01 0.1 mL

APC/Cy7 Linked Monoclonal Antibody to Cystatin 4 (CST4)

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to Cystatin 4 (CST4)
MBS2110688-02 0.2 mL

APC/Cy7 Linked Monoclonal Antibody to Cystatin 4 (CST4)

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to Cystatin 4 (CST4)
MBS2110688-03 0.5 mL

APC/Cy7 Linked Monoclonal Antibody to Cystatin 4 (CST4)

Sign In for Pricing
View Details