Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO17 Rabbit Polyclonal Antibody (HRP)

FBXO17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FBG4, FBX26, Fbx17, FBXO26

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FBXO17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_680474

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD30 Recombinant Rabbit monoclonal Antibody
HA723930 100 µL

Mouse CD30 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse CD28 (37.51) In Vivo Antibody - Low Endotoxin
ICH1055-100mg 100 mg

Anti-Mouse CD28 (37.51) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
FHL1 Recombinant Rabbit Monoclonal Antibody [JE40-35]
HA720075 100 µL

FHL1 Recombinant Rabbit Monoclonal Antibody [JE40-35]

Sign In for Pricing
View Details
Frozen Tissue Sections, Cecum
CS644004 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
19-Nordeoxycorticosterone
TRC-N668010-5MG 5 mg

19-Nordeoxycorticosterone

Sign In for Pricing
View Details
Fluo -4 AM Ultrapure (>98% purity) - Green fluorescent calcium indicator
1043G 3x 50 µg

Fluo -4 AM Ultrapure (>98% purity) - Green fluorescent calcium indicator

Sign In for Pricing
View Details