Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo47 Rabbit Polyclonal Antibody (FITC)

Fbxo47 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gm1562, 2900052P03Rik

UniProt

A2A6H3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Fbxo47

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FACVTMEMLQPVMSGDRDDDDRGFLNLFHLLHAQANFHKEVLYLTMNAIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001074904

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4P4, CT (OR4P4, OR4P3P, Olfactory receptor 4P4, Olfactory receptor 4P3) (MaxLight 550)
MBS6328884-01 0.1 mL

OR4P4, CT (OR4P4, OR4P3P, Olfactory receptor 4P4, Olfactory receptor 4P3) (MaxLight 550)

Sign In for Pricing
View Details
OR4P4, CT (OR4P4, OR4P3P, Olfactory receptor 4P4, Olfactory receptor 4P3) (MaxLight 550)
MBS6328884-02 5x 0.1 mL

OR4P4, CT (OR4P4, OR4P3P, Olfactory receptor 4P4, Olfactory receptor 4P3) (MaxLight 550)

Sign In for Pricing
View Details
LDOC1L, CT (LDOC1L, MAR6, MART6, Protein LDOC1L, Leucine zipper protein down-regulated in cancer cells-like, Mammalian retrotransposon-derived protein 6) (MaxLight 550) discontinued
037731-ML550 100 µL

LDOC1L, CT (LDOC1L, MAR6, MART6, Protein LDOC1L, Leucine zipper protein down-regulated in cancer cells-like, Mammalian retrotransposon-derived protein 6) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-Human CD61/ITGB3 Antibody (LM609), PE
MBS1582651-01 50 Tests

Anti-Human CD61/ITGB3 Antibody (LM609), PE

Sign In for Pricing
View Details
Anti-Human CD61/ITGB3 Antibody (LM609), PE
MBS1582651-02 100 Tests

Anti-Human CD61/ITGB3 Antibody (LM609), PE

Sign In for Pricing
View Details
Anti-Human CD61/ITGB3 Antibody (LM609), PE
MBS1582651-03 5x 100 Tests

Anti-Human CD61/ITGB3 Antibody (LM609), PE

Sign In for Pricing
View Details