Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD1 Rabbit Polyclonal Antibody (HRP)

KCTD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C18orf5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCTD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001136202

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chlamydophila Trachomatis rpsP Protein (aa 1-116) (strain UCH-1/proctitis)
VAng-Lsx7229-1mgEcoli 1 mg (E. coli)

Recombinant Chlamydophila Trachomatis rpsP Protein (aa 1-116) (strain UCH-1/proctitis)

Sign In for Pricing
View Details
Histone H2A.X (Phospho-S139) Antibody
E51A13750 100 µL

Histone H2A.X (Phospho-S139) Antibody

Sign In for Pricing
View Details
Human TIPRL Protein Lysate
MBS8428577-01 0.02 mg

Human TIPRL Protein Lysate

Sign In for Pricing
View Details
Human TIPRL Protein Lysate
MBS8428577-02 5x 0.02 mg

Human TIPRL Protein Lysate

Sign In for Pricing
View Details
Rabbit Monoclonal c-Myc Antibody (MYC/7682R) [DyLight 650]
NBP3-20787C 0.1 mL

Rabbit Monoclonal c-Myc Antibody (MYC/7682R) [DyLight 650]

Sign In for Pricing
View Details
4-Amino-2-furancarboxylic Acid Hydrochloride
TRC-A609680-10MG 10 mg

4-Amino-2-furancarboxylic Acid Hydrochloride

Sign In for Pricing
View Details