Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD1 Rabbit Polyclonal Antibody (HRP)

KCTD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C18orf5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCTD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001136202

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP57 Antibody
OACA08745-50UL 50 µL

CEP57 Antibody

Sign In for Pricing
View Details
PLAC8L1 (NM_001029869) Human Recombinant Protein
TP760444 50 µg

PLAC8L1 (NM_001029869) Human Recombinant Protein

Sign In for Pricing
View Details
MMP14 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-52373R-BF488 100 µL

MMP14 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Human TRPC1 Knockout HEK293T cell line
GTR15410444 1 Vial

Human TRPC1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Ubiquitin/UBB Rabbit Polyclonal Antibody (FITC)
orb2579041 100 µg

Ubiquitin/UBB Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
DAZ2 Antibody (C-term)
E45R30926G-1 100 µL

DAZ2 Antibody (C-term)

Sign In for Pricing
View Details