Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFG1L Rabbit Polyclonal Antibody (HRP)

AFG1L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AFG1, LACE1, c222389

UniProt

Q8WV93

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LACE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HGPLDHYDFLIKAHELKDDEHQRRVIQCLQKLHEDLKGYNIEAEGLFSKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_660358

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc17a5 (BC058785) Mouse Tagged ORF Clone
MG207507 10 µg

Slc17a5 (BC058785) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Psmb7 (NM_053532) Rat Tagged ORF Clone Lentiviral Particle
RR208386L3V 200 µL

Psmb7 (NM_053532) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Proteasome subunit alpha type 6 (PSMA6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]
TA800103BM 100 µL

Proteasome subunit alpha type 6 (PSMA6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]

Sign In for Pricing
View Details
Rabbit Dihydrofolate reductase (DHFR) ELISA Kit
MBS7206848-01 48 Well

Rabbit Dihydrofolate reductase (DHFR) ELISA Kit

Sign In for Pricing
View Details
Rabbit Dihydrofolate reductase (DHFR) ELISA Kit
MBS7206848-02 96 Well

Rabbit Dihydrofolate reductase (DHFR) ELISA Kit

Sign In for Pricing
View Details
Rabbit Dihydrofolate reductase (DHFR) ELISA Kit
MBS7206848-03 5x 96 Well

Rabbit Dihydrofolate reductase (DHFR) ELISA Kit

Sign In for Pricing
View Details