Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEKR1 Rabbit Polyclonal Antibody (HRP)

LEKR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ16641, FLJ37161

UniProt

Q6ZMV7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LEKR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLQETVRRECEERFELTEALSQAREQLLELSKLRGSLPFSPCSLSKGSLT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001004316

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX7 Rabbit Polyclonal Antibody
orb2952588-01 50 µg

STX7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STX7 Rabbit Polyclonal Antibody
orb2952588-02 100 µg

STX7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NUP50 Rabbit Polyclonal Antibody (BF594)
orb2391328 100 µL

NUP50 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Rabbit PACAP-38 (Pituitary Adenylate Cyclase Activating Polypeptide 38) ELISA Kit
MBS2507401-01 24 Tests

Rabbit PACAP-38 (Pituitary Adenylate Cyclase Activating Polypeptide 38) ELISA Kit

Sign In for Pricing
View Details
Rabbit PACAP-38 (Pituitary Adenylate Cyclase Activating Polypeptide 38) ELISA Kit
MBS2507401-02 48 Tests

Rabbit PACAP-38 (Pituitary Adenylate Cyclase Activating Polypeptide 38) ELISA Kit

Sign In for Pricing
View Details
Rabbit PACAP-38 (Pituitary Adenylate Cyclase Activating Polypeptide 38) ELISA Kit
MBS2507401-03 96 Tests

Rabbit PACAP-38 (Pituitary Adenylate Cyclase Activating Polypeptide 38) ELISA Kit

Sign In for Pricing
View Details