Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAS1L Rabbit Polyclonal Antibody (FITC)

MAS1L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MRG, MAS-L, dJ994E9.2

UniProt

P35410

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAS1L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_443199

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASC1 (TRIP4) Human shRNA Plasmid Kit (Locus ID 9325)
TR320612 1 Kit

ASC1 (TRIP4) Human shRNA Plasmid Kit (Locus ID 9325)

Sign In for Pricing
View Details
Proteinase K (contains Proteinase K solution)
8000124 24 mg

Proteinase K (contains Proteinase K solution)

Sign In for Pricing
View Details
SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (MaxLight 750)
MBS6240596-01 0.1 mL

SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (MaxLight 750)

Sign In for Pricing
View Details
SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (MaxLight 750)
MBS6240596-02 5x 0.1 mL

SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (MaxLight 750)

Sign In for Pricing
View Details
Rp2h Protein Lysate (Mouse) with C-HA Tag
40700034 100 µg

Rp2h Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Rat factor B (BF) ELISA Kit
GA-E0047RT-01 48 Tests

Rat factor B (BF) ELISA Kit

Sign In for Pricing
View Details