Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAS1L Rabbit Polyclonal Antibody (FITC)

MAS1L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MRG, MAS-L, dJ994E9.2

UniProt

P35410

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAS1L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_443199

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nodal homolog (NODAL) Elisa Kit
EK731358 96 Well

Mouse Nodal homolog (NODAL) Elisa Kit

Sign In for Pricing
View Details
PPIA (Peptidyl-prolyl Cis-trans Isomerase A, PPIase A, Cyclophilin A, Cyclosporin A-binding Protein, Rotamase A, CYPA, MGC117158, MGC12404, MGC23397) APC
MBS6390308-01 0.1 mL

PPIA (Peptidyl-prolyl Cis-trans Isomerase A, PPIase A, Cyclophilin A, Cyclosporin A-binding Protein, Rotamase A, CYPA, MGC117158, MGC12404, MGC23397) APC

Sign In for Pricing
View Details
PPIA (Peptidyl-prolyl Cis-trans Isomerase A, PPIase A, Cyclophilin A, Cyclosporin A-binding Protein, Rotamase A, CYPA, MGC117158, MGC12404, MGC23397) APC
MBS6390308-02 5x 0.1 mL

PPIA (Peptidyl-prolyl Cis-trans Isomerase A, PPIase A, Cyclophilin A, Cyclosporin A-binding Protein, Rotamase A, CYPA, MGC117158, MGC12404, MGC23397) APC

Sign In for Pricing
View Details
DNA Marker IV
MD1011 250 µL

DNA Marker IV

Sign In for Pricing
View Details
KLRD1 Antibody
orb51562-01 50 µg

KLRD1 Antibody

Sign In for Pricing
View Details
KLRD1 Antibody
orb51562-02 100 µg

KLRD1 Antibody

Sign In for Pricing
View Details