Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL4 Rabbit Polyclonal Antibody (HRP)

MRPL4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L4mt, CGI-28

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPL4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRSPLWRGGGVAHGPRGPTS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAG02005

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IhfB Antibody
orb818959 2 mg

IhfB Antibody

Sign In for Pricing
View Details
TNFa/TNF-alpha Human Monoclonal Antibody
orb2976577-01 100 µg

TNFa/TNF-alpha Human Monoclonal Antibody

Sign In for Pricing
View Details
TNFa/TNF-alpha Human Monoclonal Antibody
orb2976577-02 1 mg

TNFa/TNF-alpha Human Monoclonal Antibody

Sign In for Pricing
View Details
MIR548AN ORF Vector (Human) (pORF)
ORF024790 1.0 µg DNA

MIR548AN ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ARHGEF1 (Rho Guanine Nucleotide Exchange Factor (GEF) 1, GEF1, LBCL2, LSC, P115-RHOGEF, SUB1.5)
243459 100 µg

ARHGEF1 (Rho Guanine Nucleotide Exchange Factor (GEF) 1, GEF1, LBCL2, LSC, P115-RHOGEF, SUB1.5)

Sign In for Pricing
View Details
COX7a2/3 discontinued
342680-01 100 µL

COX7a2/3 discontinued

Sign In for Pricing
View Details