Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEMF Rabbit Polyclonal Antibody (Biotin)

NEMF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IDDSAPN, NY-CO-1, SDCCAG1

UniProt

O60524

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NEMF

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIP

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

118kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004704

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCOLCE2, ID (PCOLCE2, PCPE2, Procollagen C-endopeptidase enhancer 2, Procollagen COOH-terminal proteinase enhancer 2) (Azide free) (HRP)
MBS6331829-01 0.2 mL

PCOLCE2, ID (PCOLCE2, PCPE2, Procollagen C-endopeptidase enhancer 2, Procollagen COOH-terminal proteinase enhancer 2) (Azide free) (HRP)

Sign In for Pricing
View Details
PCOLCE2, ID (PCOLCE2, PCPE2, Procollagen C-endopeptidase enhancer 2, Procollagen COOH-terminal proteinase enhancer 2) (Azide free) (HRP)
MBS6331829-02 5x 0.2 mL

PCOLCE2, ID (PCOLCE2, PCPE2, Procollagen C-endopeptidase enhancer 2, Procollagen COOH-terminal proteinase enhancer 2) (Azide free) (HRP)

Sign In for Pricing
View Details
NCTC-109 Medium w/ Phenol red and coenzymes, w/o L-Glutamine and HEPES buffer
AL1138-01 500 mL

NCTC-109 Medium w/ Phenol red and coenzymes, w/o L-Glutamine and HEPES buffer

Sign In for Pricing
View Details
NCTC-109 Medium w/ Phenol red and coenzymes, w/o L-Glutamine and HEPES buffer
AL1138-02 2x 500 mL

NCTC-109 Medium w/ Phenol red and coenzymes, w/o L-Glutamine and HEPES buffer

Sign In for Pricing
View Details
NCTC-109 Medium w/ Phenol red and coenzymes, w/o L-Glutamine and HEPES buffer
AL1138-03 6x 500 mL

NCTC-109 Medium w/ Phenol red and coenzymes, w/o L-Glutamine and HEPES buffer

Sign In for Pricing
View Details
NCTC-109 Medium w/ Phenol red and coenzymes, w/o L-Glutamine and HEPES buffer
AL1138-04 20x 500 mL

NCTC-109 Medium w/ Phenol red and coenzymes, w/o L-Glutamine and HEPES buffer

Sign In for Pricing
View Details