Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUBPL Rabbit Polyclonal Antibody (Biotin)

NUBPL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IND1, huInd1, MC1DN21, C14orf127

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUBPL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079428

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PDGFC Antibody Picoband®, iFluor647 Conjugate
A03092-2-iFluor647 100 µg

Anti-PDGFC Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
EDAR (Tumor Necrosis Factor Receptor Superfamily Member EDAR, Anhidrotic Ectodysplasin Receptor 1, Downless Homolog, EDA-A1 Receptor, Ectodermal Dysplasia Receptor, Ectodysplasin-A Receptor, FLJ94390) (MaxLight 750) discontinued
126150-ML750 100 µL

EDAR (Tumor Necrosis Factor Receptor Superfamily Member EDAR, Anhidrotic Ectodysplasin Receptor 1, Downless Homolog, EDA-A1 Receptor, Ectodermal Dysplasia Receptor, Ectodysplasin-A Receptor, FLJ94390) (MaxLight 750) discontinued

Sign In for Pricing
View Details
IRF7 Antibody
ABD8143 100 µg

IRF7 Antibody

Sign In for Pricing
View Details
DNAJA3 Rabbit Polyclonal Antibody
MBS9466134-01 0.05 mL

DNAJA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNAJA3 Rabbit Polyclonal Antibody
MBS9466134-02 0.1 mL

DNAJA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNAJA3 Rabbit Polyclonal Antibody
MBS9466134-03 5x 0.1 mL

DNAJA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details