Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUBPL Rabbit Polyclonal Antibody (HRP)

NUBPL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IND1, huInd1, MC1DN21, C14orf127

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NUBPL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGIWQRLLLFGGVSLRAGGGATAPLGGSRAMVCGRQLSGAGSETLKQRRT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079428

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP2A2 Polyclonal Antibody
E90098a 100 µL

ATP2A2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human GroEL
11100P-1 1000 µg

Recombinant Human GroEL

Sign In for Pricing
View Details
D- (-) -Arabinose
sc-278915D 5 Kg

D- (-) -Arabinose

Sign In for Pricing
View Details
ANLN Antibody
A60465-50UL 50 μL

ANLN Antibody

Sign In for Pricing
View Details
Anti-Human IgG (H+L) - 70nm Gold Conjugate
AC-70-03-15 1 mL

Anti-Human IgG (H+L) - 70nm Gold Conjugate

Sign In for Pricing
View Details
KR132 rabbit pAb Antibody
orb2304824-01 50 µL

KR132 rabbit pAb Antibody

Sign In for Pricing
View Details