OR3A1 Rabbit Polyclonal Antibody (HRP)
OR3A1 Rabbit Polyclonal Antibody (HRP)
Product Specifications
Product Name Alternative
OR40, OLFRA03, OR17-40, OR17-82
UniProt
P47881
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR3A1
Clonality
Polyclonal
Conjugation
HRP
Sequence
Synthetic peptide located within the following region: CGSHLTVVAIFYGSGIFNYMRLGSTKLSDKDKAVGIFNTVINPMLNPIIY
Purification
Affinity Purified
Form
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Molecular Weight
35kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Equine, Human, Mouse, Porcine, Rabbit, Rat
Tested Applications
WB
NCBI Accession Number
NP_002541
Host or Source
Rabbit
Preservative
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2846702 100 µL
Blood Group Antigen Precursor Rabbit pAb, PE-Cy5 conjugated
Sign In for Pricing
View Details 
S8026-01C-ML650 100 µL
SUMO2, SUMO3, ID (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (MaxLight 650) discontinued
Sign In for Pricing
View Details GTR15392707 1 Vial
Lentiviral human TMEM30A sgRNA gene knockout kit - Lentiviral human TMEM30A sgRNA gene knockout kit (100)
Sign In for Pricing
View Details