Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR3A1 Rabbit Polyclonal Antibody (HRP)

OR3A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR40, OLFRA03, OR17-40, OR17-82

UniProt

P47881

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR3A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IMAGTPMALIVISYIHVAAAVLRIRSVEGRKKAFSTCGSHLTVVAIFYGS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002541

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRIM1 Rabbit Polyclonal Antibody (PerCP)
orb2460972 100 µL

CRIM1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Mouse platelet basic protein (PBP) ELISA Kit
MBS265162-01 48 Well

Mouse platelet basic protein (PBP) ELISA Kit

Sign In for Pricing
View Details
Mouse platelet basic protein (PBP) ELISA Kit
MBS265162-02 96 Well

Mouse platelet basic protein (PBP) ELISA Kit

Sign In for Pricing
View Details
Mouse platelet basic protein (PBP) ELISA Kit
MBS265162-03 5x 96 Well

Mouse platelet basic protein (PBP) ELISA Kit

Sign In for Pricing
View Details
Mouse platelet basic protein (PBP) ELISA Kit
MBS265162-04 10x 96 Well

Mouse platelet basic protein (PBP) ELISA Kit

Sign In for Pricing
View Details
FRA1/FOSL1 Rabbit Polyclonal Antibody (FITC)
orb464352 100 µL

FRA1/FOSL1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details