Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51V1 Rabbit Polyclonal Antibody (HRP)

OR51V1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-36, OR51A12

UniProt

Q9H2C8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51V1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YYALMLVICILLLDAILILFSYILILKSVLAVASQEERHKLFQTCISHIC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004760

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genorise® Biotinylated Rat H-FABP Polyclonal Antibody
GR139038 50 mg

Genorise® Biotinylated Rat H-FABP Polyclonal Antibody

Sign In for Pricing
View Details
TGF-beta receptor type-1 Antibody / TGFBR1
RQ6526 100 µg

TGF-beta receptor type-1 Antibody / TGFBR1

Sign In for Pricing
View Details
Lentiviral mouse Pycrl shRNA (UAS) - Lentiviral mouse Pycrl shRNA (UAS) (100)
GTR15264786 1 Vial

Lentiviral mouse Pycrl shRNA (UAS) - Lentiviral mouse Pycrl shRNA (UAS) (100)

Sign In for Pricing
View Details
UBE2Q1 Rabbit Polyclonal Antibody (Cy7)
orb2441005 100 µL

UBE2Q1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Recombinant Tetrahymena thermophila Histone H3.4 (HHT4)
MBS1374618-01 0.02 mg (E-Coli)

Recombinant Tetrahymena thermophila Histone H3.4 (HHT4)

Sign In for Pricing
View Details
Recombinant Tetrahymena thermophila Histone H3.4 (HHT4)
MBS1374618-02 0.1 mg (E-Coli)

Recombinant Tetrahymena thermophila Histone H3.4 (HHT4)

Sign In for Pricing
View Details