Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52A5 Rabbit Polyclonal Antibody (HRP)

OR52A5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-33

UniProt

Q9H2C5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52A5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IRVNKIYGLFVAFAILGFDIIFITLSYVQIFITVFQLPQKEARFKAFNTC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATMIN Protein Vector (Mouse) (pPM-C-His)
PV157105 500 ng

ATMIN Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin Carrier Protein G2, Ubiquitin-protein Ligase G2, UBC7) (PE)
MBS6397841-01 0.1 mL

UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin Carrier Protein G2, Ubiquitin-protein Ligase G2, UBC7) (PE)

Sign In for Pricing
View Details
UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin Carrier Protein G2, Ubiquitin-protein Ligase G2, UBC7) (PE)
MBS6397841-02 5x 0.1 mL

UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin Carrier Protein G2, Ubiquitin-protein Ligase G2, UBC7) (PE)

Sign In for Pricing
View Details
Rabbit soluble cluster of differentiation 14 (SCD14) ELISA Kit
YP-W72392-01 48 Tests

Rabbit soluble cluster of differentiation 14 (SCD14) ELISA Kit

Sign In for Pricing
View Details
Rabbit soluble cluster of differentiation 14 (SCD14) ELISA Kit
YP-W72392-02 96 Tests

Rabbit soluble cluster of differentiation 14 (SCD14) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Rmi1 shRNA (UAS) - Lentiviral mouse Rmi1 shRNA (UAS, RFP) (25)
GTR15158231 1 Vial

Lentiviral mouse Rmi1 shRNA (UAS) - Lentiviral mouse Rmi1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details