Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSGEPL1 Rabbit Polyclonal Antibody (HRP)

OSGEPL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Qri7, OSGEPL

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OSGEPL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKPPLHHAKNCDFSFTGLQHVTDKIIMKKEKEEGIEKGQILSSAADIAAT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Integrin Beta 3 (S778) ITGB3 Antibody
A00587S778 100 µL

Anti-Integrin Beta 3 (S778) ITGB3 Antibody

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Rat IgG2c Heavy Chain Secondary Antibody [Biotin]
NB7132B 1 mL

Goat Polyclonal Goat anti-Rat IgG2c Heavy Chain Secondary Antibody [Biotin]

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 26 (CX26)
TRV-0056345-01 20 µL

Polyclonal Antibody to Connexin 26 (CX26)

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 26 (CX26)
TRV-0056345-02 100 µL

Polyclonal Antibody to Connexin 26 (CX26)

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 26 (CX26)
TRV-0056345-03 200 µL

Polyclonal Antibody to Connexin 26 (CX26)

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 26 (CX26)
TRV-0056345-04 1 mL

Polyclonal Antibody to Connexin 26 (CX26)

Sign In for Pricing
View Details