Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS33 Rabbit Polyclonal Antibody (HRP)

PRSS33 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EOS

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRSS33

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_690851

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAFD1 ORF Vector (Human) (pORF)
ORF023217 1.0 µg DNA

MAFD1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
18alpha-Glycyrrhetinic acid
MBS387070-01 5 mg

18alpha-Glycyrrhetinic acid

Sign In for Pricing
View Details
18alpha-Glycyrrhetinic acid
MBS387070-02 10 mg

18alpha-Glycyrrhetinic acid

Sign In for Pricing
View Details
18alpha-Glycyrrhetinic acid
MBS387070-03 50 mg

18alpha-Glycyrrhetinic acid

Sign In for Pricing
View Details
18alpha-Glycyrrhetinic acid
MBS387070-04 5x 50 mg

18alpha-Glycyrrhetinic acid

Sign In for Pricing
View Details
Tim3 (T Cell Immunoglobulin and Mucin Domain-containing 3, T Cell Immunoglobulin Mucin 3, TIM3, TIM-3, TIMD3, FLJ14428, Hepatitis A Virus Cellular Receptor 2, HAVCR 2, HAVCR2, HAVCR-2, Kidney Injury Molecule 3, KIM-3) (AP) discontinued
T5469-92G-AP 100 µL

Tim3 (T Cell Immunoglobulin and Mucin Domain-containing 3, T Cell Immunoglobulin Mucin 3, TIM3, TIM-3, TIMD3, FLJ14428, Hepatitis A Virus Cellular Receptor 2, HAVCR 2, HAVCR2, HAVCR-2, Kidney Injury Molecule 3, KIM-3) (AP) discontinued

Sign In for Pricing
View Details