Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psmg2 Rabbit Polyclonal Antibody (Biotin)

Psmg2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cla, Tnfsf, Clast3, AW545363, Tnfsf5ip1, 1700017I17Rik

UniProt

Q9EST4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Psmg2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIRIPGGGITKTL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_598899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GEF-H1/ARHGEF2/GEF Rabbit Polyclonal Antibody (Carrier-free)
orb3110254 100 µg

GEF-H1/ARHGEF2/GEF Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)
MBS7037147-01 0.02 mg

Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)

Sign In for Pricing
View Details
Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)
MBS7037147-02 0.1 mg

Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)

Sign In for Pricing
View Details
Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)
MBS7037147-03 5x 0.1 mg

Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)

Sign In for Pricing
View Details
Rabbit anti-Juniperus ashei Pectate lyase 1 polyclonal Antibody, Biotin conjugated
MBS1497173-01 0.05 mg

Rabbit anti-Juniperus ashei Pectate lyase 1 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-Juniperus ashei Pectate lyase 1 polyclonal Antibody, Biotin conjugated
MBS1497173-02 0.1 mg

Rabbit anti-Juniperus ashei Pectate lyase 1 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details