Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB3GAP2 Rabbit Polyclonal Antibody (FITC)

RAB3GAP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P150, SPG69, WARBM2, RAB3GAP150, RAB3-GAP150

UniProt

Q9H2M9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RAB3GAP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Haptoglobin Antibody (HP/3835) [CoraFluor 1]
NBP3-14067CL1 0.1 mL

Mouse Monoclonal Haptoglobin Antibody (HP/3835) [CoraFluor 1]

Sign In for Pricing
View Details
CD161 Protein (N-Human Fc Tag, )
P510796 100 µg

CD161 Protein (N-Human Fc Tag, )

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)
MBS2059120-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)
MBS2059120-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)
MBS2059120-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)
MBS2059120-04 1 mL

Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)

Sign In for Pricing
View Details