Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB3GAP2 Rabbit Polyclonal Antibody (HRP)

RAB3GAP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P150, SPG69, WARBM2, RAB3GAP150, RAB3-GAP150

UniProt

Q9H2M9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RAB3GAP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4933425L06Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
10761154 3x 1.0 µg DNA

4933425L06Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
ERPL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0694306 1.0 µg DNA

ERPL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MCK10 Rabbit pAb
E47R0671 100 µL

MCK10 Rabbit pAb

Sign In for Pricing
View Details
6-Bromo-1,2,3,4-tetrahydro-2-oxo-1,8-naphthyridine-3-carboxylic Acid Methyl Ester
sc-207098 1 g

6-Bromo-1,2,3,4-tetrahydro-2-oxo-1,8-naphthyridine-3-carboxylic Acid Methyl Ester

Sign In for Pricing
View Details
Finafloxacin (BAY35-3377)
orb341761-01 10 mg

Finafloxacin (BAY35-3377)

Sign In for Pricing
View Details
Finafloxacin (BAY35-3377)
orb341761-02 25 mg

Finafloxacin (BAY35-3377)

Sign In for Pricing
View Details