Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH4A Rabbit Polyclonal Antibody (HRP)

RSPH4A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RSHL3, CILD11, RSPH6B, dJ412I7.1

UniProt

Q5TD94

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RSPH4A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APPQSDRTTSVIPEAGTPYPDPLEQSSDKRESTPHHTSQSEGNTFQQSQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001010892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JPT1 Rabbit Polyclonal Antibody (Biotin)
orb2103934 100 µL

JPT1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Chfr shRNA (UAS) - Lentiviral mouse Chfr shRNA (UAS, iRFP) (25)
GTR15201230 1 Vial

Lentiviral mouse Chfr shRNA (UAS) - Lentiviral mouse Chfr shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (PE)
367132-01 25 Tests

CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (PE)

Sign In for Pricing
View Details
CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (PE)
367132-02 100 Tests

CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (PE)

Sign In for Pricing
View Details
CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (PE)
367132-03 200 Tests

CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (PE)

Sign In for Pricing
View Details
Recombinant Alpaca COVID-19/SARS-CoV-2 S1-S2 Protein VHH Antibody
orb1141361-01 100 µg

Recombinant Alpaca COVID-19/SARS-CoV-2 S1-S2 Protein VHH Antibody

Sign In for Pricing
View Details