Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSRC1 Rabbit Polyclonal Antibody (HRP)

RSRC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRT70, BM-011, SFRS21, SRrp53

UniProt

Q96IZ7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RSRC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRTYSRKKGGRKSRSKSRSWSRDLQPRSHSYDRRRRHRSSSSSSYGSRRK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_057709

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APAF1 (NT) Rabbit pAb
E47R0059 100 µL

APAF1 (NT) Rabbit pAb

Sign In for Pricing
View Details
Porcine Glutathione peroxidase 1 (GPX1) ELISA Kit
201-10-0427 96 Tests

Porcine Glutathione peroxidase 1 (GPX1) ELISA Kit

Sign In for Pricing
View Details
2-Chloro-4- (3-piperidinyloxy) benzonitrile
sc-298348A 1 g

2-Chloro-4- (3-piperidinyloxy) benzonitrile

Sign In for Pricing
View Details
Recombinant Human Myosin Light Chain 5 (1-173 a.a.)
32-4266-10 10 µg

Recombinant Human Myosin Light Chain 5 (1-173 a.a.)

Sign In for Pricing
View Details
Recombinant CD30 Antibody / Rabbit Monoclonal
orb2642071 100 µg

Recombinant CD30 Antibody / Rabbit Monoclonal

Sign In for Pricing
View Details
ISM1 Antibody Blocking peptide
orb1449270 500 µg

ISM1 Antibody Blocking peptide

Sign In for Pricing
View Details