Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD1 Rabbit Polyclonal Antibody (FITC)

SAMD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6SPF0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SAMD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GKPALPGADGTPFGCPPGRKEKPSDPVEWTVMDVVEYFTEAGFPEQATAF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_612361

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1563302 Protein Vector (Rat) (pPM-C-HA)
PV300704 500 ng

RGD1563302 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
KDELR1, CT (KDELR1, ERD2.1, ER lumen protein retaining receptor 1, KDEL endoplasmic reticulum protein retention receptor 1, Putative MAPK-activating protein PM23) (MaxLight 490)
MBS6312968-01 0.1 mL

KDELR1, CT (KDELR1, ERD2.1, ER lumen protein retaining receptor 1, KDEL endoplasmic reticulum protein retention receptor 1, Putative MAPK-activating protein PM23) (MaxLight 490)

Sign In for Pricing
View Details
KDELR1, CT (KDELR1, ERD2.1, ER lumen protein retaining receptor 1, KDEL endoplasmic reticulum protein retention receptor 1, Putative MAPK-activating protein PM23) (MaxLight 490)
MBS6312968-02 5x 0.1 mL

KDELR1, CT (KDELR1, ERD2.1, ER lumen protein retaining receptor 1, KDEL endoplasmic reticulum protein retention receptor 1, Putative MAPK-activating protein PM23) (MaxLight 490)

Sign In for Pricing
View Details
MSK1 (Phospho-S376) Rabbit Polyclonal Antibody
orb393153-01 30 µL

MSK1 (Phospho-S376) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MSK1 (Phospho-S376) Rabbit Polyclonal Antibody
orb393153-02 50 μL

MSK1 (Phospho-S376) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MSK1 (Phospho-S376) Rabbit Polyclonal Antibody
orb393153-03 100 µL

MSK1 (Phospho-S376) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details