Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMM50 Rabbit Polyclonal Antibody (HRP)

SAMM50 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OMP85, SAM50, TOB55, TRG-3, CGI-51, YNL026W

UniProt

Q9Y512

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SAMM50

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056195

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LRG1 Rabbit Monoclonal Antibody
MA3543-.05 50 µL

Anti-LRG1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Transcription factor 4, TCF-4 ELISA Kit
YLA1441MO-01 48 Tests

Mouse Transcription factor 4, TCF-4 ELISA Kit

Sign In for Pricing
View Details
Mouse Transcription factor 4, TCF-4 ELISA Kit
YLA1441MO-02 96 Tests

Mouse Transcription factor 4, TCF-4 ELISA Kit

Sign In for Pricing
View Details
IGSF5 Protein Vector (Mouse) (pPM-C-HA)
24782025 500 ng

IGSF5 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SNAP23 Antibody
K06326M07G02C-01 50 ug

SNAP23 Antibody

Sign In for Pricing
View Details
SNAP23 Antibody
K06326M07G02C-02 100 ug

SNAP23 Antibody

Sign In for Pricing
View Details