Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbc1d23 Rabbit Polyclonal Antibody (Biotin)

Tbc1d23 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

W51689, AU015720, AU043671, AU043778, 4930451A13Rik, D030022P07Rik

UniProt

Q8K0F1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tbc1d23

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATRAIKQQIMKVLD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080530

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Wscd2 Pre-designed siRNA Set A
SI116107A 1 Each

Mouse Wscd2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Sterile Sample Bags, Zipper Standing,400x250,3750ml, NYPE95, Edge sealing+zipper, Cs/500 (10x50)
SBLZS2540WA 500 Pieces/Case:500 Pieces/ PACKS:1 PACKS/CASE

Sterile Sample Bags, Zipper Standing,400x250,3750ml, NYPE95, Edge sealing+zipper, Cs/500 (10x50)

Sign In for Pricing
View Details
SLITRK4 Conjugated Antibody
orb1617493 100 µL

SLITRK4 Conjugated Antibody

Sign In for Pricing
View Details
ATP Binding Cassette Transporter C10 (ABCC10) BioAssayTM ELISA Kit (Human)
152310 96 Tests

ATP Binding Cassette Transporter C10 (ABCC10) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Filter, Disk, PCTE, 0.1μm, 13mm, 100/Pk
1215605 100 Pieces/Case:1 Piece/ PACKS:100 PACKS/CASE

Filter, Disk, PCTE, 0.1μm, 13mm, 100/Pk

Sign In for Pricing
View Details
Bovine Zinc finger protein 668, ZNF668 ELISA Kit
MBS9320756-01 48 Well

Bovine Zinc finger protein 668, ZNF668 ELISA Kit

Sign In for Pricing
View Details