Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbc1d23 Rabbit Polyclonal Antibody (FITC)

Tbc1d23 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

W51689, AU015720, AU043671, AU043778, 4930451A13Rik, D030022P07Rik

UniProt

Q8K0F1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tbc1d23

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATRAIKQQIMKVLD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080530

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dkk1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4365502 1.0 µg DNA

Dkk1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Phospho-VASP (Ser157) Rabbit Polyclonal Antibody (Biotin)
orb502262 100 µL

Phospho-VASP (Ser157) Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Mouse GJA8 Protein, His (Fc)-Avi-tagged
GJA8-3573M 50 µg

Recombinant Mouse GJA8 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
FXYD3 Mouse Monoclonal Antibody [Clone ID: OTI3D8]
TA504646S 30 µL

FXYD3 Mouse Monoclonal Antibody [Clone ID: OTI3D8]

Sign In for Pricing
View Details
Recombinant Human MPO Protein, N-His
orb3062745-01 50 µg

Recombinant Human MPO Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MPO Protein, N-His
orb3062745-02 100 µg

Recombinant Human MPO Protein, N-His

Sign In for Pricing
View Details