Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbc1d23 Rabbit Polyclonal Antibody (FITC)

Tbc1d23 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

W51689, AU015720, AU043671, AU043778, 4930451A13Rik, D030022P07Rik

UniProt

Q8K0F1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tbc1d23

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATRAIKQQIMKVLD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080530

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klc1 (NM_001081959) Mouse Tagged ORF Clone
MG221657 10 µg

Klc1 (NM_001081959) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Snx27 Rabbit Polyclonal Antibody
TA363262 100 µL

Snx27 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Galnt7 (NM_144731) Mouse Tagged ORF Clone Lentiviral Particle
MR209820L3V 200 µL

Galnt7 (NM_144731) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C20orf11 Polyclonal Antibody, RBITC Conjugated
bs-9689R-RBITC 100 µL

C20orf11 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Sheep Placenta Genomic DNA
SG-413 0.1 mg

Sheep Placenta Genomic DNA

Sign In for Pricing
View Details
Anti-African malaria mosquito CLIPB14 ser4 Antibody Fluoro647 Conjugated
DZ33986-Fluoro647 200 µL/Vial

Anti-African malaria mosquito CLIPB14 ser4 Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details