Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbc1d23 Rabbit Polyclonal Antibody (HRP)

Tbc1d23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

W51689, AU015720, AU043671, AU043778, 4930451A13Rik, D030022P07Rik

UniProt

Q8K0F1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tbc1d23

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATRAIKQQIMKVLD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080530

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP2-2 (NM_033032) Human Recombinant Protein
TP329095M 100 µg

KRTAP2-2 (NM_033032) Human Recombinant Protein

Sign In for Pricing
View Details
TIF1 gamma (TRIM33) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B7]
TA500118BM 100 µL

TIF1 gamma (TRIM33) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B7]

Sign In for Pricing
View Details
Netrin 1 (NTN1) Rabbit Polyclonal Antibody
AP20679PU-N 100 µg

Netrin 1 (NTN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTA1 Antibody
8C10969-AAT 50 µg

MTA1 Antibody

Sign In for Pricing
View Details
BRD9 (NM_023924) Human Over-expression Lysate
LC432320 20 µg

BRD9 (NM_023924) Human Over-expression Lysate

Sign In for Pricing
View Details
Biotin Anti-Human CD41 Antibody[HIP8]
E-AB-F1088B-01 25 µg

Biotin Anti-Human CD41 Antibody[HIP8]

Sign In for Pricing
View Details