Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbc1d23 Rabbit Polyclonal Antibody (HRP)

Tbc1d23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

W51689, AU015720, AU043671, AU043778, 4930451A13Rik, D030022P07Rik

UniProt

Q8K0F1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tbc1d23

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATRAIKQQIMKVLD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080530

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Foam Sheet, no holes (1 each)
BV1010-00 1 Each

Foam Sheet, no holes (1 each)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS505330 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Recombinant Cytokeratin-12 Antibody
RC-16329-01 50 μL

Recombinant Cytokeratin-12 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-12 Antibody
RC-16329-02 100 µL

Recombinant Cytokeratin-12 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-12 Antibody
RC-16329-03 1 mL

Recombinant Cytokeratin-12 Antibody

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF740 conjugate, 0.1mg/mL
BNC742295-100 1x 100 µL

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details