Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMC3 Rabbit Polyclonal Antibody (Biotin)

TMC3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q7Z5M5

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence YPQPPLKPRGKPRFEPSLTESDSVSAASSSDQQNSSADQYLQVTHSQGRF

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YPQPPLKPRGKPRFEPSLTESDSVSAASSSDQQNSSADQYLQVTHSQGRF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

126 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_001074001

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-eIF4GII  (1H5)
YF-MA11094 100 ug

Anti-eIF4GII (1H5)

Sign In for Pricing
View Details
Myeloid Marker Polyclonal Antibody, RBITC Conjugated
bs-19143R-RBITC-TR 20 µL

Myeloid Marker Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Recombinant Hydra vulgaris Laminin subunit beta-1
MBS1355494-01 0.02 mg (E-Coli)

Recombinant Hydra vulgaris Laminin subunit beta-1

Sign In for Pricing
View Details
Recombinant Hydra vulgaris Laminin subunit beta-1
MBS1355494-02 0.1 mg (E-Coli)

Recombinant Hydra vulgaris Laminin subunit beta-1

Sign In for Pricing
View Details
Recombinant Hydra vulgaris Laminin subunit beta-1
MBS1355494-03 0.02 mg (Yeast)

Recombinant Hydra vulgaris Laminin subunit beta-1

Sign In for Pricing
View Details
Recombinant Hydra vulgaris Laminin subunit beta-1
MBS1355494-04 0.1 mg (Yeast)

Recombinant Hydra vulgaris Laminin subunit beta-1

Sign In for Pricing
View Details