Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMC3 Rabbit Polyclonal Antibody (HRP)

TMC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q7Z5M5

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence YPQPPLKPRGKPRFEPSLTESDSVSAASSSDQQNSSADQYLQVTHSQGRF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YPQPPLKPRGKPRFEPSLTESDSVSAASSSDQQNSSADQYLQVTHSQGRF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

126 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_001074001

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA2, CT (Endothelial Transcription Factor GATA-2, GATA-binding Protein 2, GATA2) (PE)
MBS6477557-01 0.2 mL

GATA2, CT (Endothelial Transcription Factor GATA-2, GATA-binding Protein 2, GATA2) (PE)

Sign In for Pricing
View Details
GATA2, CT (Endothelial Transcription Factor GATA-2, GATA-binding Protein 2, GATA2) (PE)
MBS6477557-02 5x 0.2 mL

GATA2, CT (Endothelial Transcription Factor GATA-2, GATA-binding Protein 2, GATA2) (PE)

Sign In for Pricing
View Details
Recombinant Leishmania tarentolae NADH-ubiquinone oxidoreductase chain 5 (ND5)
MBS7022796-01 0.02 mg

Recombinant Leishmania tarentolae NADH-ubiquinone oxidoreductase chain 5 (ND5)

Sign In for Pricing
View Details
Recombinant Leishmania tarentolae NADH-ubiquinone oxidoreductase chain 5 (ND5)
MBS7022796-02 0.1 mg

Recombinant Leishmania tarentolae NADH-ubiquinone oxidoreductase chain 5 (ND5)

Sign In for Pricing
View Details
Recombinant Leishmania tarentolae NADH-ubiquinone oxidoreductase chain 5 (ND5)
MBS7022796-03 5x 0.1 mg

Recombinant Leishmania tarentolae NADH-ubiquinone oxidoreductase chain 5 (ND5)

Sign In for Pricing
View Details
Human NUP85 Pre-designed siRNA Set B
SI010949B 1 Each

Human NUP85 Pre-designed siRNA Set B

Sign In for Pricing
View Details