Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM71 Rabbit Polyclonal Antibody (Biotin)

TRIM71 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LIN41, HYDCC1, LIN-41

UniProt

Q2Q1W2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRIM71

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034200

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gbp4 Mouse Pre-designed siRNA Set A
HY-RS18935 1 Set

Gbp4 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human TREM2 Monoclonal Antibody
ARO-A16186-01 50 µg

Human TREM2 Monoclonal Antibody

Sign In for Pricing
View Details
Human TREM2 Monoclonal Antibody
ARO-A16186-02 100 µg

Human TREM2 Monoclonal Antibody

Sign In for Pricing
View Details
Human TREM2 Monoclonal Antibody
ARO-A16186-03 1 mg

Human TREM2 Monoclonal Antibody

Sign In for Pricing
View Details
OCT4 (E125) (POU5F1, OCT3, OCT4, OTF3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3) (MaxLight 405)
MBS6327573-01 0.1 mL

OCT4 (E125) (POU5F1, OCT3, OCT4, OTF3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3) (MaxLight 405)

Sign In for Pricing
View Details
OCT4 (E125) (POU5F1, OCT3, OCT4, OTF3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3) (MaxLight 405)
MBS6327573-02 5x 0.1 mL

OCT4 (E125) (POU5F1, OCT3, OCT4, OTF3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3) (MaxLight 405)

Sign In for Pricing
View Details