Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP14C Rabbit Polyclonal Antibody (Biotin)

UTP14C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UTP14B, KIAA0266, 2700066J21Rik

UniProt

Q5TAP6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human UTP14C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EAFAGDDVIRDFLKEKREAVEASKPKDVDLTLPGWGEWGGVGLKPSAKKR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067677

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MALSU1 sgRNA gene knockout kit - Lentiviral human MALSU1 sgRNA gene knockout kit (100)
GTR15377815 1 Vial

Lentiviral human MALSU1 sgRNA gene knockout kit - Lentiviral human MALSU1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
SMPD1 / ASM Polyclonal Antibody
E-AB-67785-01 60 µL

SMPD1 / ASM Polyclonal Antibody

Sign In for Pricing
View Details
SMPD1 / ASM Polyclonal Antibody
E-AB-67785-02 120 µL

SMPD1 / ASM Polyclonal Antibody

Sign In for Pricing
View Details
SMPD1 / ASM Polyclonal Antibody
E-AB-67785-03 200 µL

SMPD1 / ASM Polyclonal Antibody

Sign In for Pricing
View Details
EXOSC2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0703406 1.0 µg DNA

EXOSC2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
FGF2 Antibody
MBS7126910-01 0.05 mL

FGF2 Antibody

Sign In for Pricing
View Details