Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOT6 Rabbit Polyclonal Antibody (FITC)

ACOT6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C14orf42, c14_5530

UniProt

Q3I5F7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACOT6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASVHAVLGEAIFYGGEPKAHSKAQVDAWQQIQTFFHKHLNGKKSVKHSKI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001032239

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Grampus griseus Cytochrome b (MT-CYB), partial
MBS7102095 Inquire

Recombinant Grampus griseus Cytochrome b (MT-CYB), partial

Sign In for Pricing
View Details
Mouse Bivm Pre-designed siRNA Set A
SI101453A 1 Each

Mouse Bivm Pre-designed siRNA Set A

Sign In for Pricing
View Details
WNT3A (Wingless-type MMTV Integration Site Family Member 3A, Protein Wnt-3a, WNT3A) (PE)
MBS6443468-01 0.1 mL

WNT3A (Wingless-type MMTV Integration Site Family Member 3A, Protein Wnt-3a, WNT3A) (PE)

Sign In for Pricing
View Details
WNT3A (Wingless-type MMTV Integration Site Family Member 3A, Protein Wnt-3a, WNT3A) (PE)
MBS6443468-02 5x 0.1 mL

WNT3A (Wingless-type MMTV Integration Site Family Member 3A, Protein Wnt-3a, WNT3A) (PE)

Sign In for Pricing
View Details
1- (2-tert-Butoxycarbonylamino-acetyl) -piperidine-4-carboxylic acid
sc-281770A 5 g

1- (2-tert-Butoxycarbonylamino-acetyl) -piperidine-4-carboxylic acid

Sign In for Pricing
View Details
CDCA7L 3'UTR Lenti-reporter-Luc Vector
15642081 1.0 µg

CDCA7L 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details