Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOXL Rabbit Polyclonal Antibody (Biotin)

ACOXL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACOXL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SRRQFGPKTKEEVKIIEHQTQTLRLMPHLATALALTFVSRYAGALLDEDV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001136280

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRAM (DRAM1) (N-term) Rabbit Polyclonal Antibody
AP08947PU-N 50 µg

DRAM (DRAM1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF488A conjugate, 0.1mg/mL
BNC882312-500 1x 500 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMAD2 (NM_005901) Human Over-expression Lysate
LY401783 100 µg

SMAD2 (NM_005901) Human Over-expression Lysate

Sign In for Pricing
View Details
ASK1 (MAP3K5) Rabbit Polyclonal Antibody
AP21014PU-N 100 µg

ASK1 (MAP3K5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS710974 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
FABP4 (NM_001442) Human Over-expression Lysate
LY400558 100 µg

FABP4 (NM_001442) Human Over-expression Lysate

Sign In for Pricing
View Details