Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOXL Rabbit Polyclonal Antibody (FITC)

ACOXL Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

E9PB20

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACOXL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AQYTKQYEEKPLFGLLQNWAESVGDKLRTSFLAFNMDTVDDLAFLLKAVK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001136279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Eno4 shRNA (UAS) - Lentiviral mouse Eno4 shRNA (UAS) plasmid
GTR15290539 1 Vial

Lentiviral mouse Eno4 shRNA (UAS) - Lentiviral mouse Eno4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Lentiviral human RRP8 sgRNA gene knockout kit - Lentiviral human RRP8 sgRNA gene knockout kit (25)
GTR15385827 1 Vial

Lentiviral human RRP8 sgRNA gene knockout kit - Lentiviral human RRP8 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
APOC1 AAV Vector (Rat) (CMV)
12176106 1 µg

APOC1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Mouse Monoclonal CD43/Sialophorin Antibody (SPN/1094) - Azide and BSA Free
NBP2-47880-0.1mg 0.1 mg

Mouse Monoclonal CD43/Sialophorin Antibody (SPN/1094) - Azide and BSA Free

Sign In for Pricing
View Details
1,6-Diisocyanatohexane 98%
D32240-01 25 mL

1,6-Diisocyanatohexane 98%

Sign In for Pricing
View Details
1,6-Diisocyanatohexane 98%
D32240-02 100 mL

1,6-Diisocyanatohexane 98%

Sign In for Pricing
View Details