Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOXL Rabbit Polyclonal Antibody (FITC)

ACOXL Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

E9PB20

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACOXL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AQYTKQYEEKPLFGLLQNWAESVGDKLRTSFLAFNMDTVDDLAFLLKAVK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001136279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (MaxLight 550)
MBS6397376-01 0.1 mL

TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (MaxLight 550)

Sign In for Pricing
View Details
TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (MaxLight 550)
MBS6397376-02 5x 0.1 mL

TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (MaxLight 550)

Sign In for Pricing
View Details
VEGF Biosimilar (Domantis patent VEGF Reference Antibody)
orb2702959-01 1 mg

VEGF Biosimilar (Domantis patent VEGF Reference Antibody)

Sign In for Pricing
View Details
VEGF Biosimilar (Domantis patent VEGF Reference Antibody)
orb2702959-02 5 mg

VEGF Biosimilar (Domantis patent VEGF Reference Antibody)

Sign In for Pricing
View Details
VEGF Biosimilar (Domantis patent VEGF Reference Antibody)
orb2702959-03 100 mg

VEGF Biosimilar (Domantis patent VEGF Reference Antibody)

Sign In for Pricing
View Details
PPP2R1B Antibody
orb1926328-01 50 µL

PPP2R1B Antibody

Sign In for Pricing
View Details