Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM2A Rabbit Polyclonal Antibody (Biotin)

ACSM2A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ACSM2, A-923A4.1

UniProt

Q08AH3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACSM2A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001010845

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (2- (Dimethylamino) ethylcarbamoyl) phenylboronic acid, pinacol ester
422356-01 100 mg

3- (2- (Dimethylamino) ethylcarbamoyl) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
3- (2- (Dimethylamino) ethylcarbamoyl) phenylboronic acid, pinacol ester
422356-02 250 mg

3- (2- (Dimethylamino) ethylcarbamoyl) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
Anti-Human CD112/Nectin-2/PVRL2 Monoclonal Antibody (ABS1310), PE
PTX24002 100 µg

Anti-Human CD112/Nectin-2/PVRL2 Monoclonal Antibody (ABS1310), PE

Sign In for Pricing
View Details
Horse NLR Family Member X1 (NLRX1) ELISA Kit
MBS9913825-01 48 Well

Horse NLR Family Member X1 (NLRX1) ELISA Kit

Sign In for Pricing
View Details
Horse NLR Family Member X1 (NLRX1) ELISA Kit
MBS9913825-02 96 Well

Horse NLR Family Member X1 (NLRX1) ELISA Kit

Sign In for Pricing
View Details
Horse NLR Family Member X1 (NLRX1) ELISA Kit
MBS9913825-03 5x 96 Well

Horse NLR Family Member X1 (NLRX1) ELISA Kit

Sign In for Pricing
View Details