Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM4 Rabbit Polyclonal Antibody (Biotin)

ACSM4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P0C7M7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACSM4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DQWSQKEKTGERPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPC

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073923

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clorprenaline (CLO) ELISA Kit
EKF1045 96 Tests

Clorprenaline (CLO) ELISA Kit

Sign In for Pricing
View Details
Growth Hormone Releasing Factor (GHRF, GRF, Growth Hormone Releasing Hormone, GHRH, MGC119781, Sermorelin, Somatocrinin, Somatoliberin, Somatorelin, MGC119781) (HRP)
127569-HRP 100 µL

Growth Hormone Releasing Factor (GHRF, GRF, Growth Hormone Releasing Hormone, GHRH, MGC119781, Sermorelin, Somatocrinin, Somatoliberin, Somatorelin, MGC119781) (HRP)

Sign In for Pricing
View Details
Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)
TRV-0032905-01 20 µL

Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)

Sign In for Pricing
View Details
Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)
TRV-0032905-02 100 µL

Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)

Sign In for Pricing
View Details
Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)
TRV-0032905-03 200 µL

Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)

Sign In for Pricing
View Details
Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)
TRV-0032905-04 1 mL

Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)

Sign In for Pricing
View Details