Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFAP1L1 Rabbit Polyclonal Antibody (FITC)

AFAP1L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AFAP1L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QVKRHASSCSEKSHRVDPQVKVKRHASSANQYKYGKNRAEEDARRYLVEK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001139809

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKB2 Protein (N-GST, Human)
P527073 100 µg

NFKB2 Protein (N-GST, Human)

Sign In for Pricing
View Details
Lentiviral human SAE1 sgRNA gene knockout kit - Lentiviral human SAE1 sgRNA gene knockout kit (plasmid)
GTR15395501 1 Vial

Lentiviral human SAE1 sgRNA gene knockout kit - Lentiviral human SAE1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PTPRE Rabbit Polyclonal Antibody (Biotin)
orb2116492 100 µL

PTPRE Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
HTATSF1 Polyclonal Conjugated Antibody
orb1628229 100 µL

HTATSF1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
FES (Feline Sarcoma Oncogene, FPS, Oncogene FES, Feline Sarcoma Virus, c-Fes/Fps Protein, Feline sarcoma/Fujinami avian sarcoma oncogene homolog)
363092 200 µL

FES (Feline Sarcoma Oncogene, FPS, Oncogene FES, Feline Sarcoma Virus, c-Fes/Fps Protein, Feline sarcoma/Fujinami avian sarcoma oncogene homolog)

Sign In for Pricing
View Details
GCLC Antibody
orb1333273 100 µg

GCLC Antibody

Sign In for Pricing
View Details