Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFAP1L1 Rabbit Polyclonal Antibody (HRP)

AFAP1L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AFAP1L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVKRHASSCSEKSHRVDPQVKVKRHASSANQYKYGKNRAEEDARRYLVEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001139809

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Feline panleukopenia virus Non-capsid protein NS-1 (NS1), partial
MBS1148001 Inquire

Recombinant Feline panleukopenia virus Non-capsid protein NS-1 (NS1), partial

Sign In for Pricing
View Details
Mouse STK11 ELISA Kit (Ready to Use)
orb554065-01 48 Tests

Mouse STK11 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Mouse STK11 ELISA Kit (Ready to Use)
orb554065-02 96 Tests

Mouse STK11 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Pias4 (NM_001100757) Rat Tagged Lenti ORF Clone
RR206674L3 10 µg

Pias4 (NM_001100757) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ATF-2 Polyclonal Antibody
JOT-AP00697-01 20 µL

ATF-2 Polyclonal Antibody

Sign In for Pricing
View Details
ATF-2 Polyclonal Antibody
JOT-AP00697-02 50 μL

ATF-2 Polyclonal Antibody

Sign In for Pricing
View Details