Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD34B Rabbit Polyclonal Antibody (HRP)

ANKRD34B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DP58

UniProt

A5PLL1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANKRD34B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KMVKYLLENNADPNIQDKSGKTALMHACLEKAGPEVVSLLLKSGADLSLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001004441

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFEMP1 Recombinant Protein (Rat)
RP199133 100 µg

EFEMP1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
CHP1 Knockout A549 Polyclonal Cells
ARG10044 1 Million

CHP1 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
RRAGD Rabbit Polyclonal Antibody (APC)
orb998532 100 µL

RRAGD Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
ATF7 (Transcription Factor ATF-A, Activating Transcription Factor 7, Cyclic AMP-dependent Transcription Factor ATF-7, cAMP-dependent Transcription Factor ATF-7, ATFA)
A0855-72F 100 µg

ATF7 (Transcription Factor ATF-A, Activating Transcription Factor 7, Cyclic AMP-dependent Transcription Factor ATF-7, cAMP-dependent Transcription Factor ATF-7, ATFA)

Sign In for Pricing
View Details
Canine Receptor-Binding Cancer Antigen Expressed on SiSo Cells (RCAS1) ELISA Kit
MBS9380891-01 48 Well

Canine Receptor-Binding Cancer Antigen Expressed on SiSo Cells (RCAS1) ELISA Kit

Sign In for Pricing
View Details
Canine Receptor-Binding Cancer Antigen Expressed on SiSo Cells (RCAS1) ELISA Kit
MBS9380891-02 96 Well

Canine Receptor-Binding Cancer Antigen Expressed on SiSo Cells (RCAS1) ELISA Kit

Sign In for Pricing
View Details