Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP11A Rabbit Polyclonal Antibody (HRP)

ARHGAP11A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GAP (1-12)

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHGAP11A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_955389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexim1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6506308 1.0 µg DNA

Hexim1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rotavirus Group A Specific Antigen, VP6 Mouse mAb
E2210004-5G2 100 µL

Rotavirus Group A Specific Antigen, VP6 Mouse mAb

Sign In for Pricing
View Details
Sfrp1 3'UTR Lenti-reporter-Luc Vector
43583086 1.0 µg

Sfrp1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
NEUROD5 sgRNA CRISPR Lentivector (Human) (Target 2)
K1419403 1.0 µg DNA

NEUROD5 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Slf1 Mouse shRNA Plasmid (Locus ID 105377)
TL505724 1 Kit

Slf1 Mouse shRNA Plasmid (Locus ID 105377)

Sign In for Pricing
View Details
APH1 Peptide
orb1236443 0.05 mg

APH1 Peptide

Sign In for Pricing
View Details