Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP11A Rabbit Polyclonal Antibody (HRP)

ARHGAP11A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GAP (1-12)

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHGAP11A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_955389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnls Rat Pre-designed siRNA Set A
HY-RS25120 1 Set

Rnls Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Hsa-miR-6782-3p miRNA Inhibitor
orb1871279-01 10 nmol

Hsa-miR-6782-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-6782-3p miRNA Inhibitor
orb1871279-02 20 nmol

Hsa-miR-6782-3p miRNA Inhibitor

Sign In for Pricing
View Details
Six3 Antibody - C-terminal region
ARP37135_P050-25UL 25 µL

Six3 Antibody - C-terminal region

Sign In for Pricing
View Details
MAPK6PS5 AAV Vector (Human) (CMV)
28068101 1 µg

MAPK6PS5 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
MYNN (Myoneurin, Zinc Finger And BTB Domain-Containing Protein 31, OSZF, ZBTB31, SBBIZ1) (MaxLight 405)
MBS6191319-01 0.1 mL

MYNN (Myoneurin, Zinc Finger And BTB Domain-Containing Protein 31, OSZF, ZBTB31, SBBIZ1) (MaxLight 405)

Sign In for Pricing
View Details