Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BZW2 Rabbit Polyclonal Antibody (HRP)

BZW2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

5MP1, MST017, HSPC028, MSTP017

UniProt

Q9Y6E2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human BZW2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054757

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB11, CT (ZBTB11, Zinc finger and BTB domain-containing protein 11) (FITC) discontinued
043991-FITC 200 µL

ZBTB11, CT (ZBTB11, Zinc finger and BTB domain-containing protein 11) (FITC) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Rhbdf1 shRNA (UAS) - Lentiviral mouse Rhbdf1 shRNA (UAS, RFP) plasmid
GTR15220285 1 Vial

Lentiviral mouse Rhbdf1 shRNA (UAS) - Lentiviral mouse Rhbdf1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
500 mL PET Square Storage Bottles, Square Shoulder Style, Sterile, double bagged bulk pacakging, 20/pk, 80/cs
CS0038-333624 1 Each

500 mL PET Square Storage Bottles, Square Shoulder Style, Sterile, double bagged bulk pacakging, 20/pk, 80/cs

Sign In for Pricing
View Details
Human PI4KAP2 qPCR Primer Pair
QH74665S 200 Tests

Human PI4KAP2 qPCR Primer Pair

Sign In for Pricing
View Details
MICAL1 (Molecule interacting with CasL Protein 1)
323860 100 µL

MICAL1 (Molecule interacting with CasL Protein 1)

Sign In for Pricing
View Details
NDUFV3 Conjugated Antibody
MBS9445578-01 0.1 mL (Biotin)

NDUFV3 Conjugated Antibody

Sign In for Pricing
View Details