Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BZW2 Rabbit Polyclonal Antibody (HRP)

BZW2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

5MP1, MST017, HSPC028, MSTP017

UniProt

Q9Y6E2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human BZW2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054757

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS5, CT (A Disintegrin And Metalloproteinase with Thrombospondin Motif 5, A Disintegrin-like and Metalloprotease (Reprolysin type) with Thrombospondin Type 1 Motif 5, ADAM Metallopeptidase with Thrombospondin Type 1 Motif 5, ADAM-TS5, ADAM-TS 5, A Disintegrin and Metalloproteinase with Thrombospondin Motifs 11, ADAM-TS 11, ADAMTS-11, ADMP2, Aggrecanase 2, FLJ36738, Implantin, ThromboSpondin Motif-5) (MaxLight 405) discontinued
A0859-61G-ML405 100 µL

ADAMTS5, CT (A Disintegrin And Metalloproteinase with Thrombospondin Motif 5, A Disintegrin-like and Metalloprotease (Reprolysin type) with Thrombospondin Type 1 Motif 5, ADAM Metallopeptidase with Thrombospondin Type 1 Motif 5, ADAM-TS5, ADAM-TS 5, A Disintegrin and Metalloproteinase with Thrombospondin Motifs 11, ADAM-TS 11, ADAMTS-11, ADMP2, Aggrecanase 2, FLJ36738, Implantin, ThromboSpondin Motif-5) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PRKAR1A Protein Vector (Rat) (pPB-N-His)
PV296067 500 ng

PRKAR1A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
TRPV5 Rabbit Polyclonal Antibody (Fluoro550)
orb3108442 100 µg

TRPV5 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
HnRNP LL Polyclonal Antibody
orb1413434 100 µL

HnRNP LL Polyclonal Antibody

Sign In for Pricing
View Details
CD172a (Sirp alpha) (MaxLight 405)
MBS6252412-01 0.1 mL

CD172a (Sirp alpha) (MaxLight 405)

Sign In for Pricing
View Details
CD172a (Sirp alpha) (MaxLight 405)
MBS6252412-02 5x 0.1 mL

CD172a (Sirp alpha) (MaxLight 405)

Sign In for Pricing
View Details